Salinisphaera sp. LB1: SALB1_1817 Help Entry SALB1_1817        CDS       T05476                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism saln  Salinisphaera sp. LB1 Pathway saln02020   Two-component system saln02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:saln00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SALB1_1817  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     SALB1_1817  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:saln02035]     SALB1_1817 Bacterial motility proteins [BR:saln02035]  Flagellar system   Flagellar assembly proteins    Others     SALB1_1817 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AWN16015 UniProt:  A0A2Z3J6I5 LinkDB All DBs Position complement(1952517..1952810) Genome browser AA seq 97 aa AA seqDB search MPIDPTRQKSINRVNTGQSAESTSGARRPEGARSDASAASAGSTHLSKLDTSNPSHDIST ARVAEIRQGIADGTLTFDTGRIADGIIASARELTGHN NT seq 294 nt NT seq  +upstreamnt  +downstreamnt gtgcccatagacccgacacgtcaaaagagcatcaatcgcgtcaacaccggccagagtgcc gaatccacctcgggcgcccgacgcccggagggcgcacgcagcgatgcgtcggccgcaagc gccggatcgacccacctgagcaagctcgatacgagcaaccccagccacgacatcagcacc gcgcgcgtcgccgagatccgccagggcatcgccgacggtacgctgaccttcgacaccggg cgcatcgccgacggcattatcgccagtgcgcgcgagctcacgggccacaactag

DBGET integrated database retrieval system