Salinisphaera sp. LB1: SALB1_2320 Help Entry SALB1_2320        CDS       T05476                                  Name (GenBank) Cell division protein FtsL   KO K03586   cell division protein FtsL Organism saln  Salinisphaera sp. LB1 Brite KEGG Orthology (KO) [BR:saln00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:saln03036]     SALB1_2320 Chromosome and associated proteins [BR:saln03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     SALB1_2320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Sigma_1_2 Motif Other DBs NCBI-ProteinID:  AWN16518 LinkDB All DBs Position 2508339..2508608 Genome browser AA seq 89 aa AA seqDB search MTRRVLVLLTLLALNVISAIGVVESTHRTRELFHQLQSARLTQDQLTTKWAQIQLEDSAW ASPDRVSQVARNKLGMIQPRHYVVLGDKQ NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgacccgccgcgtgctggtgctgctcaccctgctggcgctcaacgtgattagcgcgatc ggggtggtggaatccacgcacaggacgcgcgaactttttcaccagttgcagtcggcccgc ctgacccaggaccagctgaccaccaagtgggcgcagatccagctcgaggacagcgcctgg gccagcccggaccgggtctctcaggtggcccgtaacaagctcggcatgatccagccgcgc cactacgtcgtgctcggagacaagcagtga

DBGET integrated database retrieval system