Salinisphaera sp. LB1: SALB1_3288 Help Entry SALB1_3288        CDS       T05476                                  Name (GenBank) Acyl carrier protein (ACP1)   KO K02078   acyl carrier protein Organism saln  Salinisphaera sp. LB1 Pathway saln00998   Biosynthesis of various antibiotics saln01100   Metabolic pathways saln01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saln00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SALB1_3288    00074 Mycolic acid biosynthesis     SALB1_3288   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SALB1_3288 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AWN17482 UniProt:  A0A2Z3J869 LinkDB All DBs Position complement(3608444..3608725) Genome browser AA seq 93 aa AA seqDB search MSEQSDLERDVAQLLVTSLDLDDVAAAEIEPTAPLFGPEADGLGLDSIDALEIALAVNQA YGIELRADDEANSRIFATLRSLSAHIERERAEA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgagtgagcaaagcgatctcgagcgcgatgtcgcacagctgctggtgacgtctctggat ctggacgatgtcgctgccgcggagatcgaacccacggcgccgctgttcgggccggaggcc gacggcctgggcctcgattcgatcgacgccctggaaatcgcgctggccgtgaatcaggcc tatggaatcgagttgcgcgccgacgacgaagccaacagccgcatattcgccacgctgcga tcgctgagcgcgcatatcgagcgcgaacgcgccgaggcttga

DBGET integrated database retrieval system