Salvelinus sp. IW2-2015 (Arctic char): 111957488 Help Entry 111957488         CDS       T05762                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp04137   Mitophagy - animal salp04140   Autophagy - animal salp04144   Endocytosis salp04145   Phagosome salp04148   Efferocytosis salp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:salp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111957488    04145 Phagosome     111957488    04140 Autophagy - animal     111957488    04137 Mitophagy - animal     111957488    04148 Efferocytosis     111957488  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111957488  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:salp04131]     111957488   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:salp04147]     111957488    04031 GTP-binding proteins [BR:salp04031]     111957488 Membrane trafficking [BR:salp04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     111957488 Exosome [BR:salp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111957488   Exosomal proteins of other body fluids (saliva and urine)    111957488   Exosomal proteins of colorectal cancer cells    111957488   Exosomal proteins of bladder cancer cells    111957488 GTP-binding proteins [BR:salp04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     111957488 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase PduV-EutP cobW nSTAND3 AAA_16 Septin AAA_22 AAA_7 ATP_bind_1 NTPase_1 AAA_24 AAA_5 G-alpha SRPRB FLYWCH_N ATPase_2 NACHT NB-ARC DUF5992 ABC_tran AAA_14 ATP-synt_ab Motif Other DBs NCBI-GeneID:  111957488 NCBI-ProteinID:  XP_023834090 LinkDB All DBs Position LG33:complement(17207682..17211454) Genome browser AA seq 205 aa AA seqDB search MMSRKKILLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFSF VVLGNKIDLENRQVTTKRAQAWCTSKGSIPYFETSAKEAINVEQAFQTICRNALKQESEV ETYDFPDQIKLRDDRPASSGDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgatgtctcggaagaagattctactcaaggtgataattcttggagactcaggagttggg aagacctctctcatgaaccaatatgtgaataagaagttcagcaatcagtataaggccaca atcggtgctgactttcttaccaaagaggtgatggtggatgacaggcttgtgacaatgcag atctgggacactgcagggcaggagagattccagtcattgggcgttgctttctatcgaggt gcagactgttgtgtccttgtgtacgatgttactgctccaaacaccttcaagactcttgac agctggcgagacgagttcctgattcaagccagcccccgtgacccagagaacttctcattt gttgtgctcggcaacaagattgacttggagaacaggcaggtgacgaccaagcgagcccag gcgtggtgtacgagtaagggcagtatcccatatttcgagacaagtgcgaaggaggccatc aatgttgaacaagcctttcaaactatttgccgaaatgctctcaaacaggagtcagaagtg gagacttatgacttcccagatcagatcaaactgagggatgacagaccagcctcctctggt gatggctgcagctgctga

DBGET integrated database retrieval system