Salvelinus sp. IW2-2015 (Arctic char): 111961782 Help Entry 111961782         CDS       T05762                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp04137   Mitophagy - animal salp04140   Autophagy - animal salp04144   Endocytosis salp04145   Phagosome salp04148   Efferocytosis salp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:salp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111961782    04145 Phagosome     111961782    04140 Autophagy - animal     111961782    04137 Mitophagy - animal     111961782    04148 Efferocytosis     111961782  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111961782  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:salp04131]     111961782   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:salp04147]     111961782    04031 GTP-binding proteins [BR:salp04031]     111961782 Membrane trafficking [BR:salp04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     111961782 Exosome [BR:salp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111961782   Exosomal proteins of other body fluids (saliva and urine)    111961782   Exosomal proteins of colorectal cancer cells    111961782   Exosomal proteins of bladder cancer cells    111961782 GTP-binding proteins [BR:salp04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     111961782 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 nSTAND3 PduV-EutP AAA_16 NTPase_1 Septin AAA_22 AAA_24 AAA_7 DUF5992 AAA_5 ATPase_2 SRPRB NACHT ABC_tran NB-ARC AAA_14 ATP-synt_ab Motif Other DBs NCBI-GeneID:  111961782 NCBI-ProteinID:  XP_023840075 LinkDB All DBs Position LG4q.1:29:complement(28378010..28382543) Genome browser AA seq 204 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKRFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTTKRAQAWCASKNNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPSSSDGCSC NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcctcccgtaagaaggtgctgctgaaggtgatcatcctcggagactctggggtaggg aagacatcgctgatgaaccagtatgtaaataagaggttcagtaaccaatacaaggccact ataggagctgacttcctcactaaggaggtgatggtggatgacaggctggtcaccatgcag atctgggacacggcagggcaggagcggtttcaatctctgggtgtggcgttctaccgtggg gctgactgctgtgtgctggtctatgatgtcacggcgcccaacacctttaagactctggac agttggagggatgagttcctgatccaggccagccccagagacccagataacttccccttt gtggtgctaggcaacaagattgacctcgagaacagacaggtgacgacaaagcgtgcccag gcctggtgtgccagtaagaacaacatcccctactttgagaccagtgccaaggaagccatc aacgtagaccaagcattccagaccatcgcccgcaacgccctcaaacaggagtctgaggtg gagacgtatgacttcccagaccagatcaaactgagagacgaccggccctcctccagcgac ggctgctcctgctga

DBGET integrated database retrieval system