Salvelinus sp. IW2-2015 (Arctic char): 111963888 Help Entry 111963888         CDS       T05762                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp04137   Mitophagy - animal salp04140   Autophagy - animal salp04144   Endocytosis salp04145   Phagosome salp04148   Efferocytosis salp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:salp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111963888    04145 Phagosome     111963888    04140 Autophagy - animal     111963888    04137 Mitophagy - animal     111963888    04148 Efferocytosis     111963888  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111963888  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:salp04131]     111963888   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:salp04147]     111963888    04031 GTP-binding proteins [BR:salp04031]     111963888 Membrane trafficking [BR:salp04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     111963888 Exosome [BR:salp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111963888   Exosomal proteins of other body fluids (saliva and urine)    111963888   Exosomal proteins of colorectal cancer cells    111963888   Exosomal proteins of bladder cancer cells    111963888 GTP-binding proteins [BR:salp04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     111963888 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 PduV-EutP nSTAND3 Septin AAA_16 DUF5992 NTPase_1 AAA_7 AAA_22 AAA_24 G-alpha AAA_5 SRPRB ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  111963888 NCBI-ProteinID:  XP_023843218 LinkDB All DBs Position LG5:10177808..10185427 Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTTKRAQAWCASKNSIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPAAPSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctcccgtaagaaggtgctgctgaaggtgatcatcctcggagactctggggtaggg aagacttctctgatgaaccagtatgtaaataagaagttcagtaaccagtacaaggccact ataggagctgacttcctcaccaaggaggtgatggtggacgacaggctggtcaccatgcag atctgggatacggcggggcaggagcggttccagtctctgggcgtggcgttctaccgcggr gctgactgctgtgtgctggtctacgacgtcacggcgcccaacaccttcaagacactggac agctggagggatgagttcctgatccaggccagccccagagacccagacaacttccccttt gtggtgctaggcaacaagattgacctcgagaacagacaggtgacgacaaaacgtgcccag gcctggtgtgccagtaagaacagcatcccgtactttgagaccagcgccaaggaggccatc aacgtagaccaagcattccagaccattgcccgcaatgccctgaaacaggagtctgaggtg gagacgtatgacttcccagaccagatcaaactgagagacgaccggcccgccgcccccagc gacggctgctcctgctga

DBGET integrated database retrieval system