Salvelinus sp. IW2-2015 (Arctic char): 111966581 Help Entry 111966581         CDS       T05762                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp04137   Mitophagy - animal salp04140   Autophagy - animal salp04142   Lysosome biogenesis salp04144   Endocytosis salp04145   Phagosome salp04148   Efferocytosis salp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:salp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111966581    04145 Phagosome     111966581    04142 Lysosome biogenesis     111966581    04140 Autophagy - animal     111966581    04137 Mitophagy - animal     111966581    04148 Efferocytosis     111966581  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111966581  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:salp04131]     111966581   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:salp04147]     111966581    04031 GTP-binding proteins [BR:salp04031]     111966581 Membrane trafficking [BR:salp04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     111966581 Exosome [BR:salp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111966581   Exosomal proteins of other body fluids (saliva and urine)    111966581   Exosomal proteins of colorectal cancer cells    111966581   Exosomal proteins of bladder cancer cells    111966581 GTP-binding proteins [BR:salp04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     111966581 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 AAA_16 Septin AAA_22 AAA_7 NTPase_1 AAA_5 AAA_24 ATPase_2 ABC_tran AAA_14 NACHT Motif Other DBs NCBI-GeneID:  111966581 NCBI-ProteinID:  XP_023847114 LinkDB All DBs Position LG1:complement(36484161..36495546) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKTSAEACTC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctcctgaaagtcatcatcctgggggattctggagttggg aagacctccctgatgaaccagtatgtgaataggaagttcagtaaccagtacaaagctaca ataggagctgacttcctgaccaaggargtgatggtggacgatcggctcgtcacaatgcag atctgggacacggcagggcaagagaggttccagtctctgggtgtggcgttctaccgcggg gcagactgctgtgtgctggtatttgacgtaactgcccccaacaccttcaagactctagac agctggagggacgagttcctgatccaggccagtcccagagaccctgagaacttccccttt gtggtgctaggcaacaagatcgacctggagaacagacaggtgacgaccaagcgggctcag gcatggtgtcagagtaagaacaacatcccctactttgagaccagtgccaaggaggccatc aacgtagagcaggccttccagaccattgcacgcaacgccctcaaacaggagactgaggtg gagctgtataatgaattcccagagcccatcaagctagacaggaatgacagagcaaagact tcagcagaggcctgcacctgctga

DBGET integrated database retrieval system