Salvelinus sp. IW2-2015 (Arctic char): 111969495 Help Entry 111969495         CDS       T05762                                  Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp04010   MAPK signaling pathway salp04137   Mitophagy - animal salp04140   Autophagy - animal salp04218   Cellular senescence salp04371   Apelin signaling pathway salp04625   C-type lectin receptor signaling pathway salp04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:salp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111969495    04371 Apelin signaling pathway     111969495  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111969495    04137 Mitophagy - animal     111969495   09143 Cell growth and death    04218 Cellular senescence     111969495   09142 Cell motility    04810 Regulation of actin cytoskeleton     111969495  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111969495  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:salp04147]     111969495    04031 GTP-binding proteins [BR:salp04031]     111969495 Exosome [BR:salp04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111969495   Exosomal proteins of bladder cancer cells    111969495 GTP-binding proteins [BR:salp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111969495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 SLFN-g3_helicase FeoB_N Motif Other DBs NCBI-GeneID:  111969495 NCBI-ProteinID:  XP_023851440 LinkDB All DBs Position LG10:20355145..20391834 Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKSGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggcagggtggaaggacggctcggtgcaggagaagtatcgactggttgtggttggaggt ggtggtgtcgggaagtcagccctaactatacaatttatccagtcctactttgtcactgac tatgatcccacaattgaagactcgtatacgaagcagtgtgtcattgacgagagggcggcc cggcttgacatcctggacacggccggacaggaagagtttggagccatgagagaacaatac atgaggacaggggagggcttcctgcttgtcttctcagtcactgacagaggaagctttgaa gaaatctacaaattccaaagacagatcctcagagtcaaagaccgtgatgaatttcccatg atccttgtaggcaataaagcagatctggagctccagagacaggtgacccaggaggagggc cagcagctggccagacagctcaaggtgacgtatatggaggcctcagccaaaatccgtatg aatgtagaccaggctttccacgagctggttagagtaatcaggaaattccaggaacaggaa tgcccgccctcgccagaacccacgcggaaagaaaaggacaagagtggctgccattgtgtg atcgtctga

DBGET integrated database retrieval system