Salvelinus sp. IW2-2015 (Arctic char): 111980468
Help
Entry
111980468 CDS
T05762
Name
(RefSeq) S-phase kinase-associated protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
salp
Salvelinus sp. IW2-2015 (Arctic char)
Pathway
salp03083
Polycomb repressive complex
salp04110
Cell cycle
salp04114
Oocyte meiosis
salp04120
Ubiquitin mediated proteolysis
salp04141
Protein processing in endoplasmic reticulum
salp04310
Wnt signaling pathway
salp04350
TGF-beta signaling pathway
salp05132
Salmonella infection
Brite
KEGG Orthology (KO) [BR:
salp00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
111980468
04120 Ubiquitin mediated proteolysis
111980468
09126 Chromosome
03083 Polycomb repressive complex
111980468
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
111980468
04350 TGF-beta signaling pathway
111980468
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
111980468
04114 Oocyte meiosis
111980468
09160 Human Diseases
09171 Infectious disease: bacterial
05132 Salmonella infection
111980468
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
salp04131
]
111980468
04121 Ubiquitin system [BR:
salp04121
]
111980468
03036 Chromosome and associated proteins [BR:
salp03036
]
111980468
Membrane trafficking [BR:
salp04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
111980468
Ubiquitin system [BR:
salp04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
111980468
Cul7 complex
111980468
Chromosome and associated proteins [BR:
salp03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
111980468
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
111980468
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
111980468
NCBI-ProteinID:
XP_023866973
LinkDB
All DBs
Position
LG20:complement(26029849..26036460)
Genome browser
AA seq
163 aa
AA seq
DB search
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atgcccacaattaaactgcaaagctcagatggagagatctttgaggtggatgtggaaata
gctaagcagtctgttacaataaagacaatgctggaagatttgggtatggatgatgaagga
gatgatgatccagtccccctcccgaatgtgaatgcagccatcctcaagaaggtgatccag
tggtgcacccaccataaagacgacccccctccccccgaggatgacgagaacaaggagaag
aggacggacgacattcccgtctgggaccaggaattcctcaaagtggaccaagggactctc
ttcgaactcattctggccgcaaactatttggacatcaaaggactgctagatgtcacctgc
aagacggtggccaacatgataaaaggcaagaccccagaggagatcaggaagacgttcaat
atcaaaaatgacttcacagaggaggaggaagcccaggtacgcaaggagaaccagtggtgt
gaagagaaataa
DBGET
integrated database retrieval system