Salvelinus sp. IW2-2015 (Arctic char): 111981499 Help Entry 111981499         CDS       T05762                                  Name (RefSeq) permeability factor 2-like   KO K10030   interleukin 8 Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp04060   Cytokine-cytokine receptor interaction salp04218   Cellular senescence salp04620   Toll-like receptor signaling pathway salp04621   NOD-like receptor signaling pathway salp04622   RIG-I-like receptor signaling pathway salp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:salp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111981499  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     111981499  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111981499    04621 NOD-like receptor signaling pathway     111981499    04622 RIG-I-like receptor signaling pathway     111981499  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111981499  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:salp04052]     111981499    00536 Glycosaminoglycan binding proteins [BR:salp00536]     111981499 Cytokines and neuropeptides [BR:salp04052]  Cytokines   Chemokines    111981499 Glycosaminoglycan binding proteins [BR:salp00536]  Heparan sulfate / Heparin   Chemokines    111981499 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  111981499 NCBI-ProteinID:  XP_023868549 LinkDB All DBs Position LG20:complement(75915342..75917140) Genome browser AA seq 97 aa AA seqDB search MSIRMSASLVVVLLALLTITEGMSLRGVGADLRCRCIETESRRIGKLIKKMEMFPPSSHC RDTEIIATLSKSGQEICLDVSAPWVKRVIEKMLANNK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagaatgtcagccagccttgtcgttgtgctcctggccctcctgaccattact gaggggatgagtctgagaggcgtgggggctgacctgcgatgtcgctgcattgagacggag agcagacgtattggtaaactcattaagaagatggagatgttccctcccagctcgcactgc agagacactgagatcattgccactctgagcaagagtggtcaggagatttgtctggatgtc agcgctccttgggtcaaragggtcattgagaagatgctggccaacaacaaatga

DBGET integrated database retrieval system