Salvelinus sp. IW2-2015 (Arctic char): 111981980 Help Entry 111981980         CDS       T05762                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp04814   Motor proteins Brite KEGG Orthology (KO) [BR:salp00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     111981980  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:salp03037]     111981980    04812 Cytoskeleton proteins [BR:salp04812]     111981980 Cilium and associated proteins [BR:salp03037]  Motile cilia and associated proteins   Dynein arm    111981980 Cytoskeleton proteins [BR:salp04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      111981980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  111981980 NCBI-ProteinID:  XP_023869260 LinkDB All DBs Position LG20:complement(68900184..68902447) Genome browser AA seq 106 aa AA seqDB search MAETTESKKEEADYKRLHSFPLIRHTDMPEEMRVETMELCVTACEKFATNNENAAKMIKE TMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKCA NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcagagacaacagagagcaagaaggaggaggccgattacaagaggctccacagcttc ccactcatcaggcacacagacatgccagaggagatgagagtggaaacgatggaactgtgt gtcacagcctgtgagaagtttgccaccaataatgagaacgcggcgaagatgatcaaagag acgatggataaaaagtttggcagctcgtggcacgtggtgattggtgagggctttggcttc gaggtgacacacgaggtcaagaacctgctctacatgttctttggaggcagcctggctgtg tgtgtgtggaagtgtgcttag

DBGET integrated database retrieval system