Salvelinus sp. IW2-2015 (Arctic char): 112068512 Help Entry 112068512         CDS       T05762                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:salp00001]  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112068512  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:salp04147]     112068512    04990 Domain-containing proteins not elsewhere classified [BR:salp04990]     112068512 Exosome [BR:salp04147]  Exosomal proteins   Exosomal proteins of microglial cells    112068512 Domain-containing proteins not elsewhere classified [BR:salp04990]  EF-hand domain-containing proteins   S100 proteins    112068512 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 DEK_C DAXX_hist_bd Motif Other DBs NCBI-GeneID:  112068512 NCBI-ProteinID:  XP_023991440 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MPSQLERSMQSLITVFHRYADKDGDCNTLSKKELKELMQTELGSFLKSQKDPAAIDTIMK NLDQNGDGMVNFEEFVSLVVDLSIACEQIYQLHIMKAAAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagttggagagatccatgcagtccctgatcacggtgttccatcgctatgcc gacaaggacggtgactgtaacacactgagcaaaaaggagctgaaagaactcatgcagaca gaactgggcagcttcctgaagtcccagaaggacccagccgccatagacacgatcatgaag aatctggaccagaatggtgatgggatggtaaacttcgaggagtttgtctctctggtggtg gacctctccatcgcctgtgaacagatctaccagctccacatcatgaaggctgccgctaag aagtga

DBGET integrated database retrieval system