Salvelinus sp. IW2-2015 (Arctic char): 112070707 Help Entry 112070707         CDS       T05762                                  Name (RefSeq) fibroblast growth factor 7-like   KO K04358   fibroblast growth factor Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp04010   MAPK signaling pathway salp04020   Calcium signaling pathway salp04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:salp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112070707    04020 Calcium signaling pathway     112070707  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112070707  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:salp04052]     112070707    00536 Glycosaminoglycan binding proteins [BR:salp00536]     112070707 Cytokines and neuropeptides [BR:salp04052]  Cytokines   Growth factors (RTK binding)    112070707 Glycosaminoglycan binding proteins [BR:salp00536]  Heparan sulfate / Heparin   Growth factors/receptors    112070707 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  112070707 NCBI-ProteinID:  XP_023993918 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MSSVIVRFIGILEVRTVSEGGVLAIKGVKSQYYISMNRTGLLQGKKIYNENCNFKEIFLE NYFNAYSSVKSSRDGKEMFIALSQKGRPLRGKKTRREHITSHFIPMKCREEERTGV NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgtcctctgtgattgttaggtttataggtatcctggaggtccgtacggtgtccgaggga ggagtgttagctatcaaaggagtgaagagtcagtactatatctccatgaacaggactggc ctgctgcaaggcaagaaaatctacaatgagaactgcaacttcaaggagattttcctagaa aactacttcaacgcttactcgtctgttaagtcgagtagagacggcaaggagatgttcatt gctctgtctcaaaagggcagaccgctgagagggaagaagaccaggagggaacacatcacc tcccacttcattcccatgaaatgcagagaggaggagaggactggcgtctga

DBGET integrated database retrieval system