Salvelinus sp. IW2-2015 (Arctic char): 808550 Help Entry 808550            CDS       T05762                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp00190   Oxidative phosphorylation salp01100   Metabolic pathways Module salp_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:salp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     808550 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:salp03029]     808550 (ND4L) Enzymes [BR:salp01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      808550 (ND4L) Mitochondrial biogenesis [BR:salp03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     808550 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  808550 NCBI-ProteinID:  NP_008681 UniProt:  Q7IYL8 LinkDB All DBs Position MT:11066..11362 Genome browser AA seq 98 aa AA seqDB search MTPVHFSFTSAFILGLMGLAFHRTHLLSALLCLEGMMLSLFIALSLWALQMEATGYSVAP MLLLAFSACEASAGLALLVATARTHGTDRLQSLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacaccagtacacttcagctttacctcagcctttatcctagggcttataggactcgca tttcaccgcacccatcttctctcagcccttctatgtttagaaggtataatattatctcta tttattgccctatccctatgagccctccagatagaagcaactggctactcagtagctccc atacttctgctagcattttcagcctgtgaggccagcgcaggcctagccctgctagtagca actgcacgaactcatggcacggaccgcctccaaagcctaaatctactccaatgttaa

DBGET integrated database retrieval system