Candidatus Syntrophocurvum alkaliphilum: SYNTR_1282 Help Entry SYNTR_1282        CDS       T06326                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism salq  Candidatus Syntrophocurvum alkaliphilum Pathway salq00020   Citrate cycle (TCA cycle) salq00720   Other carbon fixation pathways salq01100   Metabolic pathways salq01110   Biosynthesis of secondary metabolites salq01120   Microbial metabolism in diverse environments salq01200   Carbon metabolism salq01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:salq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     SYNTR_1282   09102 Energy metabolism    00720 Other carbon fixation pathways     SYNTR_1282 Enzymes [BR:salq01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SYNTR_1282 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_10 Fer4_6 Fer4_9 Fer4_8 Fer4_17 Fer4_4 Fer4_16 Fer4_15 Fer4_13 Fer4_3 Phage_int_SAM_3 Motif Other DBs NCBI-ProteinID:  QGT99875 UniProt:  A0A6I6DB16 LinkDB All DBs Position complement(1302610..1302825) Genome browser AA seq 71 aa AA seqDB search MPKGRVRFVAELCKACQLCVRFCPKDVLSLDKHIINVLGYHPVKAINPDDCNGCATCALM CPDLVITVERE NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgccgaagggaagagttcgttttgttgctgaactctgtaaagcatgtcagctttgtgtt cgtttttgtcctaaagatgtcttatcattggacaagcatatcatcaacgttttaggctac catccggtaaaagcaattaatccagatgattgtaatgggtgtgcaacttgcgcactgatg tgtccggatcttgttattacggtagaaagggagtga

DBGET integrated database retrieval system