Streptomyces albus: SLNWT_3327 Help Entry SLNWT_3327        CDS       T03823                                  Name (GenBank) thioesterase   KO K02078   acyl carrier protein Organism sals  Streptomyces albus Pathway sals00998   Biosynthesis of various antibiotics sals01100   Metabolic pathways sals01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sals00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SLNWT_3327    00074 Mycolic acid biosynthesis     SLNWT_3327   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SLNWT_3327 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AJE83703 UniProt:  A0A0B5EMJ6 LinkDB All DBs Position complement(4031590..4031850) Genome browser AA seq 86 aa AA seqDB search MTATEVNKEDLRGIVADALEADREEVGDQADFAEELEVDSLVQLEISSQVENSYGISIEE VLASGVTTLDELYGFVTARLAERHPA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttgaccgccaccgaggtgaacaaggaagacctgcgcggcatcgtcgccgacgcgctggag gccgaccgcgaagaggtcggcgaccaggccgacttcgcggaggagctggaggtcgactcg ctggtccagctggagatctcctcccaggtggagaactcctacggcatctccatcgaggag gtcctcgcctccggcgtgacgaccctcgacgagctgtacggcttcgtcaccgcccgcctg gccgagcggcacccggcatga

DBGET integrated database retrieval system