Salegentibacter sp. T436: AO058_13210 Help Entry AO058_13210       CDS       T04614                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism salt  Salegentibacter sp. T436 Brite KEGG Orthology (KO) [BR:salt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:salt03032]     AO058_13210    03036 Chromosome and associated proteins [BR:salt03036]     AO058_13210    03400 DNA repair and recombination proteins [BR:salt03400]     AO058_13210 DNA replication proteins [BR:salt03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AO058_13210 Chromosome and associated proteins [BR:salt03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AO058_13210 DNA repair and recombination proteins [BR:salt03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AO058_13210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg Arteri_nsp7a VWA_2 DUF6927 Motif Other DBs NCBI-ProteinID:  APS39779 UniProt:  A0A1L6R5D2 LinkDB All DBs Position 3026978..3027250 Genome browser AA seq 90 aa AA seqDB search MNKTDLIDAMAENAGISKAAAKKALESFLENVEKSLKKGDRVSLVGFGSWSVSKRAAREG RNPQTGKTIKIAAKNVVKFKAGADLQKAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagatttaattgatgcaatggctgaaaacgctggaatctcaaaagcagca gcaaaaaaagccttagaatctttcctggaaaacgtagaaaaatctcttaaaaaaggagat cgtgtttctttagtaggatttggatcttggtcagtttctaaaagagctgcccgtgaagga agaaacccacaaaccggaaaaaccattaaaattgctgctaaaaatgtagtgaaatttaag gccggtgcagatttacaaaaagctgtaaactaa

DBGET integrated database retrieval system