Snodgrassella alvi: SALWKB2_0022 Help Entry SALWKB2_0022      CDS       T03063                                  Name (GenBank) Glutaredoxin 3 (Grx3)   KO K03676   glutaredoxin 3 Organism salv  Snodgrassella alvi Brite KEGG Orthology (KO) [BR:salv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:salv03110]     SALWKB2_0022 Chaperones and folding catalysts [BR:salv03110]  Protein folding catalysts   Protein disulfide isomerase    SALWKB2_0022 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 DUF6870 Thioredoxin_3 GrpE Motif Other DBs NCBI-ProteinID:  AHN27404 UniProt:  X2H1Z1 LinkDB All DBs Position complement(31429..31686) Genome browser AA seq 85 aa AA seqDB search MQPITMYTTGVCPYCQMAKALLKQKGVTDINEIRIDTDAQIREQMMQRTGRRTVPQIYIG EVHVGGFDDLNALNQAGKLDALLAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaaccgattaccatgtataccaccggggtatgcccttattgccagatggccaaagca ttactcaaacaaaaaggtgtaaccgatatcaatgagatccggattgatacggatgcgcaa atccgagagcagatgatgcagcgtaccggccgccggactgttccgcagatttatatcggt gaggtacatgtcggcggctttgatgatttgaatgctttgaatcaagcaggtaaactagac gctctgctcgcaggttaa

DBGET integrated database retrieval system