Streptomyces alboniger: CP975_23595 Help Entry CP975_23595       CDS       T06908                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism salw  Streptomyces alboniger Brite KEGG Orthology (KO) [BR:salw00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CP975_23595 Enzymes [BR:salw01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CP975_23595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_2 Thioredoxin GST_N_3 GST_N_2 Motif Other DBs NCBI-ProteinID:  QEV20112 UniProt:  A0A5J6HLL7 LinkDB All DBs Position complement(5247776..5248033) Genome browser AA seq 85 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKGQMDREGIAYEEINIEQDPDSAAFVEKANGGNQTVPTLLV ISASGTESVMTNPSLAQVKQALDAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgccgggcactgtgacgatgtacagcaccacgtggtgcggctactgccgccgcctcaag ggtcagatggaccgtgagggcatcgcgtacgaggagatcaacatcgagcaggacccggac tcggcggccttcgtcgagaaggcgaacggcggaaaccagacggttccgacgctcctggta atttccgccagtggtacggagtcggtcatgacgaacccgtcgctcgctcaggtcaagcag gcgctcgacgcagcctga

DBGET integrated database retrieval system