Streptomyces alboniger: CP975_33405 Help Entry CP975_33405       CDS       T06908                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism salw  Streptomyces alboniger Pathway salw00998   Biosynthesis of various antibiotics salw01100   Metabolic pathways salw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP975_33405    00074 Mycolic acid biosynthesis     CP975_33405   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP975_33405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 PH_15 Motif Other DBs NCBI-ProteinID:  QEV21769 UniProt:  A0A5J6HN88 LinkDB All DBs Position 7618889..7619176 Genome browser AA seq 95 aa AA seqDB search MTMTLEEATHRAGARQELAEGVKCLLVERLSLDVDPTTIGDDQPLFGRGLELDSIDTLEL AMAVEDTYGVTITDDDTHSLLSLNRLVDHIEAAWT NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgacgatgaccctcgaagaggccacccaccgcgccggagcgcgccaggaactggccgaa ggcgtcaagtgccttctggtggaacggctctcactggacgtcgaccccacgacgatcggc gacgaccagccgctcttcggccgaggcctggaactggactccatcgacaccctggaactc gcgatggccgtcgaggacacctacggcgtcactatcaccgacgacgacacgcacagcctg ctctcactcaaccggctcgtggaccacatcgaggcggcctggacatga

DBGET integrated database retrieval system