Streptomyces alboniger: CP975_33735 Help Entry CP975_33735       CDS       T06908                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism salw  Streptomyces alboniger Pathway salw00998   Biosynthesis of various antibiotics salw01100   Metabolic pathways salw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP975_33735    00074 Mycolic acid biosynthesis     CP975_33735   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP975_33735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 NusG_add Motif Other DBs NCBI-ProteinID:  QEV21824 UniProt:  A0A0D3RJB8 LinkDB All DBs Position 7691952..7692182 Genome browser AA seq 76 aa AA seqDB search MYESVKSLLTNEFKISEDRIAPDSTLEDLGLDSLASVEFALALEKGFGVEITDDEVVELE RLDRIVELVERRKQAS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtgtacgaatcggtcaagtccctgctcaccaacgaattcaagatctccgaggaccggata gccccggactccacgctggaggacctcggcctggactccctggcgtcggtcgagttcgcc ctcgccctggagaagggattcggcgtggagatcaccgacgacgaggtcgtcgagctggag cggctcgacaggatcgtcgaactcgtcgagcgccgcaagcaagcatcctga

DBGET integrated database retrieval system