Salmonella sp. SSDFZ69: EOS98_13570 Help Entry EOS98_13570       CDS       T06160                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism salz  Salmonella sp. SSDFZ69 Pathway salz01100   Metabolic pathways salz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EOS98_13570    00074 Mycolic acid biosynthesis     EOS98_13570   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EOS98_13570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AZY98542 LinkDB All DBs Position complement(2704276..2704512) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagtaaccaacaatgcttctttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system