Streptomyces ambofaciens: SAM23877_6976 Help Entry SAM23877_6976     CDS       T04055                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism samb  Streptomyces ambofaciens Pathway samb00998   Biosynthesis of various antibiotics samb01100   Metabolic pathways samb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:samb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SAM23877_6976 (acpP)    00074 Mycolic acid biosynthesis     SAM23877_6976 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SAM23877_6976 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 bHLH_NCOA Motif Other DBs NCBI-ProteinID:  AKZ60021 UniProt:  A0ACW4 LinkDB All DBs Position 7516407..7516685 Genome browser AA seq 92 aa AA seqDB search MPSTADERQLLDELRELLAATVEDLSTEEIRPDSSLKDDLGVDSLAMLELIAAIEDRWQI EVPQEQAERLTTVRQIAAHLAEAVTTPAGGTA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgccgtccaccgctgatgaacgacagctcctcgacgaactgcgcgaactgctggccgcg accgtggaggacctctccacggaggagatccgacccgactcctccctgaaggacgacctc ggcgtcgactcgctggccatgctggaactcatcgccgccatcgaggaccgctggcagatc gaggtgccgcaggagcaggcggagcggctgacgacggtgcgacagatcgccgcccacctc gccgaagccgtcaccaccccggcgggcgggaccgcgtga

DBGET integrated database retrieval system