Streptomyces ambofaciens: SAM23877_7479 Help Entry SAM23877_7479     CDS       T04055                                  Symbol alpC Name (GenBank) Acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism samb  Streptomyces ambofaciens Pathway samb00253   Tetracycline biosynthesis samb01056   Biosynthesis of type II polyketide backbone samb01100   Metabolic pathways samb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:samb00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     SAM23877_7479 (alpC)    00253 Tetracycline biosynthesis     SAM23877_7479 (alpC)  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:samb01004]     SAM23877_7479 (alpC)    01008 Polyketide biosynthesis proteins [BR:samb01008]     SAM23877_7479 (alpC) Lipid biosynthesis proteins [BR:samb01004]  Polyketide synthase   Component type    SAM23877_7479 (alpC) Polyketide biosynthesis proteins [BR:samb01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      SAM23877_7479 (alpC)     Nonaketide PKS      SAM23877_7479 (alpC)     Decaketide PKS      SAM23877_7479 (alpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKZ60520 UniProt:  Q1RQS2 LinkDB All DBs Position 8141504..8141773 Genome browser AA seq 89 aa AA seqDB search MATKLFTLDDLKRTLRDAAGVAEGVDLDGDILDTEFEVIGYESLALLEAGSLIEREYGIS LDEEAVGEANTPRTFIEVVNAQLAPAQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggccaccaagctcttcaccctcgacgacctcaagcgcaccctgcgcgacgccgcgggc gtcgccgagggcgtggacctggacggcgacatcctcgacaccgagttcgaggtcatcggc tacgagtccctcgccctgctggaggccggcagcctcatcgagcgcgagtacggcatctcc ctcgacgaggaggccgtcggcgaggccaacaccccccgcaccttcatcgaggtcgtcaac gcccagctcgcgcccgcccaggccgcctga

DBGET integrated database retrieval system