Sinorhizobium americanum: SAMCFNEI73_Ch0739 Help Entry SAMCFNEI73_Ch0739 CDS       T04621                                  Name (GenBank) hypothetical protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism same  Sinorhizobium americanum Pathway same00362   Benzoate degradation same00622   Xylene degradation same01100   Metabolic pathways same01120   Microbial metabolism in diverse environments same01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:same00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     SAMCFNEI73_Ch0739    00622 Xylene degradation     SAMCFNEI73_Ch0739    00621 Dioxin degradation     SAMCFNEI73_Ch0739 Enzymes [BR:same01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      SAMCFNEI73_Ch0739 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  APG90063 UniProt:  A0A1L3LJ69 LinkDB All DBs Position 768074..768271 Genome browser AA seq 65 aa AA seqDB search MPIVRIELFPGRSAETKAEIGLEITKVLEAVAGIKPTATTVIFTEISPLDWLVAGEPFSA HAQLK NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgccgattgtcagaatcgaattgtttcccggccgcagtgctgagacgaaagccgagatc ggtctcgagatcaccaaagtgctcgaggcggtcgccggcatcaagccgaccgctacgacg gtcatcttcaccgagatatcgcccttggattggcttgtcgccggcgagcctttcagcgcc cacgctcaactgaagtga

DBGET integrated database retrieval system