Sinorhizobium americanum: SAMCFNEI73_Ch1205 Help Entry SAMCFNEI73_Ch1205 CDS       T04621                                  Symbol acpP Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism same  Sinorhizobium americanum Pathway same01100   Metabolic pathways same01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:same00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SAMCFNEI73_Ch1205 (acpP)    00074 Mycolic acid biosynthesis     SAMCFNEI73_Ch1205 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SAMCFNEI73_Ch1205 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  APG90519 UniProt:  A0A1L3LK92 LinkDB All DBs Position 1220544..1220780 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtgaagaaaattgttattgatcaccttggcgtcgatgcc gaaaaagttagcgaaggcgcaagcttcatcgacgacctcggcgcggactcgctcgacacc gtcgaactggtcatggccttcgaagaagaattcggcgtcgaaatcccggacgacgcggcg gattcgatcctgaccgtcggcgacgccgtcaagttcatcgaaaaggcccaggcctaa

DBGET integrated database retrieval system