Staphylococcus aureus MS4: NI36_06365 Help Entry NI36_06365        CDS       T04800                                  Name (GenBank) RNA-binding protein   KO K03666   host factor-I protein Organism sams  Staphylococcus aureus MS4 Pathway sams02024   Quorum sensing sams03018   RNA degradation Brite KEGG Orthology (KO) [BR:sams00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NI36_06365  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NI36_06365  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sams03019]     NI36_06365    03036 Chromosome and associated proteins [BR:sams03036]     NI36_06365 Messenger RNA biogenesis [BR:sams03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NI36_06365 Chromosome and associated proteins [BR:sams03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NI36_06365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 MBG DUF4809 StiP Motif Other DBs NCBI-ProteinID:  ALQ99499 UniProt:  A0A0D1I1E7 LinkDB All DBs Position 1316190..1316423 Genome browser AA seq 77 aa AA seqDB search MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAI STYTVETEGQESTESEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgattgcaaacgaaaacatccaagacaaagcactagagaattttaaagcaaaccaaact gaagtaactgtattctttctaaacggtttccaaatgaaaggtgttattgaagaatacgac aagtatgtcgtaagcttaaattctcaaggcaaacaacacttgatttacaaacatgcgatc agcacttatacagtagaaactgaaggtcaagaatctactgaaagtgaagaataa

DBGET integrated database retrieval system