Sandaracinus amylolyticus: DB32_002872 Help Entry DB32_002872       CDS       T03935                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism samy  Sandaracinus amylolyticus Pathway samy01100   Metabolic pathways samy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:samy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DB32_002872    00074 Mycolic acid biosynthesis     DB32_002872   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DB32_002872 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AKF05723 UniProt:  A0A0F6W2F6 LinkDB All DBs Position complement(3332814..3333056) Genome browser AA seq 80 aa AA seqDB search MSDSDLREKLREIIAEVSEVDEIPDETPFKELGIDSMMAIEIVAEVERTFKLSIPEDELK KMTHFTAVYDLVKSKLAAAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcggacagcgacctgagggagaagctccgcgagatcatcgccgaggtgagcgaggtc gacgagatcccggacgagactcccttcaaggagctcgggatcgactcgatgatggcgatc gagatcgtcgcggaggtggagcgcaccttcaagctctcgatccccgaggacgagctcaag aagatgacgcacttcacggcggtatacgacctcgtgaagagcaagctcgccgccgcggct tga

DBGET integrated database retrieval system