Sandaracinus amylolyticus: DB32_003888 Help Entry DB32_003888       CDS       T03935                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism samy  Sandaracinus amylolyticus Pathway samy01100   Metabolic pathways samy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:samy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DB32_003888    00074 Mycolic acid biosynthesis     DB32_003888   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DB32_003888 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AKF06739 UniProt:  A0A0F6SFD2 LinkDB All DBs Position 4477260..4477496 Genome browser AA seq 78 aa AA seqDB search MEIADKVKEIVSQQLDVDVAQIKPESQFIDDLGADSLAIVELVLAFEEQFEIDIPDEDTE KIRTVGDAISYISTRTKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggagatcgcagacaaggtcaaggagatcgtctcgcagcagctcgacgtcgacgtcgcg cagatcaagccggagtcgcagttcatcgacgacctcggcgccgactcgctcgcgatcgtg gagctcgtgctcgcgttcgaagagcagttcgagatcgacatccccgacgaggacaccgag aagatccgcacggtcggcgacgcgatttcctatatctcgacgcgtaccaagaagtga

DBGET integrated database retrieval system