Sandaracinobacteroides saxicola: H3309_03625
Help
Entry
H3309_03625 CDS
T06739
Name
(GenBank) acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha
KO
K01965
propionyl-CoA carboxylase alpha subunit [EC:
6.4.1.3
]
Organism
sand
Sandaracinobacteroides saxicola
Pathway
sand00280
Valine, leucine and isoleucine degradation
sand00630
Glyoxylate and dicarboxylate metabolism
sand00640
Propanoate metabolism
sand01100
Metabolic pathways
sand01110
Biosynthesis of secondary metabolites
sand01120
Microbial metabolism in diverse environments
sand01200
Carbon metabolism
Module
sand_M00741
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:
sand00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
H3309_03625
00640 Propanoate metabolism
H3309_03625
09105 Amino acid metabolism
00280 Valine, leucine and isoleucine degradation
H3309_03625
Enzymes [BR:
sand01000
]
6. Ligases
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.3 propionyl-CoA carboxylase
H3309_03625
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
PCC_BT
Biotin_carb_C
Biotin_lipoyl
Dala_Dala_lig_C
Biotin_lipoyl_2
ATP-grasp
DUF2118
ATP-grasp_5
QRPTase_N
HlyD_3
RnfC_N
RPOC_hybrid
ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID:
QMW23596
UniProt:
A0A7G5IJQ4
LinkDB
All DBs
Position
722418..724409
Genome browser
AA seq
663 aa
AA seq
DB search
MFKKILIANRGEIACRVVRTARRMGIATVAVYSDADAAALHVEMADEAVHLGPPPAAQSY
LLADRIIAACKATGAEAVHPGYGFLSERASFVETLDAAGIAFIGPPASAIAAMGDKIESK
KLAKAAGVNVVPGFVGEIADTDHAARIAGEIGYPVMMKASAGGGGKGMRLAFSEADVREG
FDAVRREALASFGDDRVFIEKFVEQPRHIEIQLLGDRHGTILYLNERDCSIQRRHQKVVE
EAPSPFVTPEMRRAMGEQAVALARNVGYFSAGTVEFIAGADRSFYFLEMNTRLQVEHPVT
ECITGLDLVEQMIRVAAGERLALSQGDIGINGHAIETRFYAEDPYRGFLPSIGRLTRYLP
PTEEGGVRVDSGVVEGSEISMFYDPMIAKLITHAPTRLQAADAQVAALDRYVVRGISHNA
DFLSALMQHPRFRAGEAVTTAFIAEEYPDGFKGHPATADVRARLVAAAAVVNAILADRAQ
MIDGQLNGHGAAWGTDWVVELDGERTPVTVVDHGGLWDVAVGGAQLRVRGQWRPGEPLFE
AEIDDVAMAIQLDRLGVGWRMTHGGAQHAMRVLSPRAAELAGHMIAKVAPDLSRFLLCPM
PGLVVSIAVAEGDRVEAGQALATVEAMKMENILRAEKAGTVARLHAKAGDSLAVDAVILE
FAA
NT seq
1992 nt
NT seq
+upstream
nt +downstream
nt
atgttcaagaaaatcctgattgccaatcgtggggaaatcgcctgccgggtcgtccggacg
gcgcggcgcatggggatcgccacggtcgccgtctattccgatgccgatgcggcggcgctg
catgtggagatggcggacgaagccgtgcatctggggccgccgccggcggcgcaatcctat
ctgctggcggaccggatcatcgcggcgtgcaaggcgacgggggccgaggcggtgcatccg
ggatacgggttcctgagcgagcgggcttcgttcgtggagacgctcgacgcggcggggatc
gcgtttatcggcccgccggcaagcgccatcgccgcgatgggcgacaagatcgaatcgaag
aagctggcgaaggccgccggtgtgaacgtggtgcctggctttgtgggagagattgccgac
accgaccatgcggcgcggatcgccggcgagatcggctatccggtgatgatgaaggcaagc
gcgggcggcggcggcaaggggatgcggctggccttcagcgaggccgatgtgcgcgagggg
ttcgatgctgtgcggcgggaggcgctggcgagtttcggcgacgaccgggtgttcatcgag
aaattcgtggagcagccgcggcatatcgaaatccagctgctgggcgataggcacggcacc
atcctctatctgaacgagcgcgactgttcgatccagcggcggcaccagaaggtggtggag
gaagcgccgagcccgttcgtgacgcccgagatgcggcgcgcgatgggcgagcaggcggtc
gcgctcgcgcgcaatgtcggttatttcagcgcggggacggtggagttcatcgccggcgcc
gaccgcagtttctattttctggagatgaacacgcggctccaggtggagcatccggtgacc
gagtgcatcaccgggctggacctggtggaacagatgatccgcgtggcggcgggcgagcgg
ctggcgctgagccagggcgacatcggcatcaacggccatgccatcgagacgcgattctat
gccgaggacccctatcgcgggttcctgccctcgatcggccggctgacacgctatctgccg
ccgacggaggaagggggcgtgcgggtggacagcggcgtggtggagggcagcgagatttcg
atgttctatgatccgatgatcgccaagctgatcacgcatgcgccgacccggctgcaagcg
gcggatgcgcaggtggcggcgctggatcgctatgtcgtgcgcggcatcagccacaacgcc
gatttcctgtcggcgctgatgcagcatccgcgttttcgggccggcgaggcggtgacgacg
gcgttcatcgcggaggaatatcccgacgggttcaagggccatccggccacggcggacgtg
cgggcgcggttggtggcggcagcggcggtggtgaacgcgattctcgccgaccgggcgcag
atgatcgacggtcagctgaacgggcatggcgccgcctgggggacggactgggtggtggag
ctggacggcgagcgcacgccggtgacggtggtggaccatggcgggctgtgggatgtggcc
gtcgggggtgcgcagttgcgggtgcggggccagtggcggccgggcgagccgctgttcgag
gccgagatcgacgatgtggcgatggcgatccagctcgaccggctgggcgtgggctggcgg
atgacgcatggcggcgcgcagcacgccatgcgggtgctgagcccgcgcgccgcggagctg
gcggggcacatgatcgccaaggtcgcgccggacctgagccgcttcctgctgtgcccgatg
ccggggctggtggtgagcatcgcggtggccgagggggatcgggtggaggccgggcaggcg
ctggcgacggtggaggcgatgaagatggagaatatcctgcgcgccgagaaagccggcacg
gtggcgcggctgcacgccaaggccggggacagcctggcggtggatgccgtgatcctggag
ttcgcggcgtga
DBGET
integrated database retrieval system