Sandaracinobacteroides saxicola: H3309_09850
Help
Entry
H3309_09850 CDS
T06739
Name
(GenBank) sigma-54-dependent Fis family transcriptional regulator
Organism
sand
Sandaracinobacteroides saxicola
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sigma54_activat
Response_reg
Sigma54_activ_2
HTH_8
AAA_5
Mg_chelatase
AAA
HTH_50
AAA_16
AAA_2
MCM
HTH_28
Motif
Other DBs
NCBI-ProteinID:
QMW24607
UniProt:
A0A7G5IML5
LinkDB
All DBs
Position
complement(1958930..1960333)
Genome browser
AA seq
467 aa
AA seq
DB search
MSVSGQWEGWLETRPSLLIVDDDRDVLLSARLALRAHASEIVTAESADGLPALYARHRPD
VVLLDMNYSRGSTSGQEGFRALEALKAAAPEAVVLVITAHGGVNIAVEAMKRGATDFVSK
PWVNERLVASVKTAAALGASRREAATERQRTAVAAAPARETPLLGHSAAMREVLSLIERA
APTDANVLILGENGTGKELVAREIHARSGRAARALVSVDLGAVAESLFDSELFGHLKGAF
TDAKADRIGRLQAADGGTLFLDEIGNLPLHLQPKLLTALEQRQVTPVGSNRAVAIDVRVV
AATNAGQAALNDEARFRPDLLFRLNTVTIQVPPLRARREDVPGLLAHYLPLFARKYGRAE
RPLPADVLAALCAHDWPGNVRELRHVAERAVILATGDAFALSDFALAAAVARAPVAPVAE
GDLNLDRAERRMIEAALKKHGYNISLAAGELGLTRASLYRRMEKHGL
NT seq
1404 nt
NT seq
+upstream
nt +downstream
nt
atgtccgtttccggacagtgggaggggtggttggagacgcggccgagcctgctgattgtg
gatgacgaccgggatgtgctgttgtcggcgcggctggcgctgcgcgcgcatgcgtcggag
atcgtgacggcggagagcgcggacgggctgccggcgctttacgcgcggcatcggccggac
gtggtgctgctggacatgaactattcgcgcggcagcaccagcgggcaggagggattccgc
gcgctggaggcgctgaaggcggcggcgcccgaggcggtggtgctggtgatcaccgcccat
ggcggggtgaacatcgcggtggaggcgatgaagcgcggggcgacggatttcgtcagcaag
ccctgggtgaatgagcggctggtggcgagcgtgaagaccgcggcggcgctgggggcgagc
cggcgggaggcggcgaccgagcggcagcgcaccgcggtggcggcggcgccagcgcgggaa
acgccgctgctgggacattcggcggcgatgcgggaagtgctctccctgatcgagcgggcg
gcgccgaccgatgccaatgtgctgatcctgggggagaatggcacgggcaaggagctggtg
gcgcgggagatccatgcgcgatcggggcgggcggcgcgggcgctggtgtcggtcgacctg
ggggcggtggcggagagcctgttcgacagcgagctgttcggccatctgaagggggcgttc
accgatgccaaggcggaccggatcggccggttgcaggcggcggatggcggcacgctgttc
ctggacgagatcggcaacctgccgctgcacctgcaacccaagctgctgaccgcgctggag
cagcggcaggtaacgccggtggggagcaaccgggcggtggcgatcgatgtgcgggtggtg
gcggcgaccaatgccggacaggcggcgctgaacgacgaggcccgtttccgccccgacctg
ctgttccggttgaacacggtgacgattcaagtgccgcccttgcgggcaagacgcgaggat
gtgccggggttgctggcgcattatctgccgctgttcgcgcgcaaatatgggcgggcggag
cggccgctgccggcggatgtgctggcggcgctgtgcgcgcatgactggccgggcaatgtg
cgcgaactgcggcatgtggcggagcgggcggtgatcctggcgacgggggacgcctttgcg
ctgtccgattttgcgctggcagcggcggtggcgcgggcgccggtggcgccggtggccgag
ggggatctgaacctggaccgggcggagcggcggatgatcgaggcggcgctgaagaagcat
ggctacaacatctcgctggcggcgggcgagttggggctgacgcgggcgtcgctgtatcgc
cgcatggaaaagcacgggttgtga
DBGET
integrated database retrieval system