KEGG   Sandaracinobacteroides saxicola: H3309_11280
Entry
H3309_11280       CDS       T06739                                 
Symbol
ftsY
Name
(GenBank) signal recognition particle-docking protein FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
sand  Sandaracinobacteroides saxicola
Pathway
sand02024  Quorum sensing
sand03060  Protein export
sand03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sand00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    H3309_11280 (ftsY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H3309_11280 (ftsY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    H3309_11280 (ftsY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sand02044]
    H3309_11280 (ftsY)
Secretion system [BR:sand02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   H3309_11280 (ftsY)
SSDB
Motif
Pfam: SRP54 SRP54_N AAA_30 AAA_22 AAA_16 AAA_17 Zeta_toxin CbiA NACHT DO-GTPase2 AAA_19 AAA_24 AAA_33 Thymidylate_kin ABC_tran T2SSE SIS_2 APS_kinase DLIC AAA_23 ATPase MobB AAA_29 AAA_15 SMC_N AAA_21 AAA_7
Other DBs
NCBI-ProteinID: QMW21959
UniProt: A0A7G5IF17
LinkDB
Position
2248076..2249014
AA seq 312 aa
MTDTTEKTGWLARMRGGLARSTEKLGASLSGLIGGGAIDAETIEAIEEALIAADLGPAFA
ARLAARLADERQRGSITEKQARALIAREIAAVLAPVARPLEITAFPRPHTILVVGVNGSG
KTTTIAKLGHLFQEADYGVMFAAGDTFRAAAVEQLKVWGSRLDIPVISAEVGADAAGLAY
TAMEQGRASGRDVLLVDTAGRLQNKGGLMEELAKVKRVLAKQLPAAPHDVLLVLDATTGQ
NALEQIRVFQEIGGVTGLVMTKLDGTARGGVLVAAAERFRLPIHAIGVGEKLGDLRPFDA
RAFADALAGVNE
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaccgacaccaccgaaaagaccggctggctcgcccgcatgcgcggcggcctcgcccgc
tccaccgagaagctgggcgccagcctctccggcctgatcggcggcggcgccatcgacgcc
gagaccatcgaggcgatcgaggaggcgctgatcgccgccgacctcggccccgccttcgcc
gcccgcctcgccgcgcgcctggcggacgagcgccagcgcggcagcatcacggagaaacag
gcccgcgccctgatcgcccgcgaaatcgccgccgtgctcgcccccgtcgcccgcccgctg
gagatcaccgccttcccccgcccgcacaccatcctggtcgtcggcgtcaacggcagcggc
aagaccaccaccatcgccaagctgggtcatttgttccaggaggccgactatggcgtgatg
ttcgccgccggcgacaccttccgcgccgccgcggtcgaacagctgaaggtctggggcagc
cggctggacatccccgtcatcagtgccgaggtcggcgccgacgccgccggcctcgcctat
accgcgatggaacagggccgcgcctcgggccgcgacgtgctcttggtcgataccgccggc
cggctgcagaacaagggcgggctgatggaggagctggcgaaggtgaagcgcgtgctggcg
aaacagctgccggccgcgccgcacgacgtgctgctggtgctggacgccaccaccggccag
aatgcgctggaacagatccgcgtcttccaggaaatcggcggcgtcaccggcctcgtcatg
accaagctcgacggtaccgcgcgcggcggcgtgctggtcgccgccgccgaacgtttccgc
ctgccgatccatgccatcggcgtcggcgaaaaactgggcgacctgcgcccgttcgacgcg
cgggccttcgccgatgcccttgccggagtgaatgaatga

DBGET integrated database retrieval system