Sandaracinobacteroides saxicola: H3309_12145 Help Entry H3309_12145       CDS       T06739                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sand  Sandaracinobacteroides saxicola Pathway sand01100   Metabolic pathways sand01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sand00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3309_12145    00074 Mycolic acid biosynthesis     H3309_12145   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3309_12145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QMW22114 UniProt:  A0A7G5IFH2 LinkDB All DBs Position 2408319..2408588 Genome browser AA seq 89 aa AA seqDB search MLKDDVITQIAGFIRHVRRDEALAIDADTRIDTLGIDSLDFVELLFMIEEKFDIDIGFNA NADGSFPFETVGSAADAVCQLVGSKTVPA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcttaaggacgacgtgatcacccagatcgccggcttcatccgtcatgtgcggcgggat gaagcgctggccatcgacgccgacacccggatcgacacgctcggcatcgactcgctcgat ttcgtcgaactgctgttcatgatcgaggagaagttcgatatcgacatcggcttcaacgcc aacgccgacggcagcttcccgttcgaaaccgtgggcagcgccgccgacgcggtctgccag ctcgtgggcagcaagacggttccagcgtga

DBGET integrated database retrieval system