Sandaracinobacteroides saxicola: H3309_13545 Help Entry H3309_13545       CDS       T06739                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sand  Sandaracinobacteroides saxicola Pathway sand01100   Metabolic pathways sand01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sand00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3309_13545    00074 Mycolic acid biosynthesis     H3309_13545   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3309_13545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QMW22360 UniProt:  A0A7G5IG68 LinkDB All DBs Position complement(2688744..2688980) Genome browser AA seq 78 aa AA seqDB search MSDVADRVKKIVVEHLGVEADKVTNEASFIDDLGADSLDTVELVMAFEDEFGVEIPDDAA EKILTVQNAIDFIAANGK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgcagaccgggtgaagaagatcgttgtcgagcatctgggggtggaggcc gacaaggtcacgaacgaggcgagctttatcgacgacctgggcgccgacagcctggacacg gtggagctggtgatggcgttcgaggatgagttcggcgtggagattccggacgatgccgcg gagaagatcctgacggtgcagaacgccatcgatttcatcgcggcgaacgggaaataa

DBGET integrated database retrieval system