KEGG   Sandaracinobacteroides saxicola: H3309_14725
Entry
H3309_14725       CDS       T06739                                 
Symbol
surE
Name
(GenBank) 5'/3'-nucleotidase SurE
  KO
K03787  5'/3'-nucleotidase [EC:3.1.3.5 3.1.3.6]
Organism
sand  Sandaracinobacteroides saxicola
Pathway
sand00230  Purine metabolism
sand00240  Pyrimidine metabolism
sand00760  Nicotinate and nicotinamide metabolism
sand01100  Metabolic pathways
sand01110  Biosynthesis of secondary metabolites
sand01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:sand00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    H3309_14725 (surE)
   00240 Pyrimidine metabolism
    H3309_14725 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    H3309_14725 (surE)
Enzymes [BR:sand01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     H3309_14725 (surE)
    3.1.3.6  3'-nucleotidase
     H3309_14725 (surE)
SSDB
Motif
Pfam: SurE
Other DBs
NCBI-ProteinID: QMW24716
UniProt: A0A7G5IMX4
LinkDB
Position
2937077..2937832
AA seq 251 aa
MRILLTNDDGINAPGFAALERIAAQLSDDVWMVAPAEEQSGAGHSLTLTRPLRMRQPGER
RFAIAGTPTDSVMMALGMVMKDSPPDLILSGVNRGPNMAEDVTYSGTVSAAMEGTLAGVR
SIALSQAMNDYTVGNESFASAEASAADIIRRVAAAPWHPGTLVNINFPTRAEPLGVRVTE
QGFRDYGHIAIERRVDPRGYPYFWFGYGREIETPAHRTDLEAVRAGYVSVTPLHLDLTAR
EAMAALAATLE
NT seq 756 nt   +upstreamnt  +downstreamnt
atgcgcatcctgctgaccaacgacgacggcatcaacgcgccgggcttcgccgcgctggag
cggatcgcggcgcaactgtccgacgatgtctggatggtggcgccggcggaggaacagtcc
ggcgccggccattcgctgacgctgacccgcccgctgcggatgcggcagccgggcgaacgt
cgcttcgccatcgccggcacgccgacggacagcgtgatgatggcgctggggatggtgatg
aaggacagcccgcccgacctgatcctgtccggcgtcaaccgcggcccgaacatggcggag
gatgtgacgtatagtggcaccgtctccgccgcgatggaggggacgctggcgggcgtgcgc
tcgatcgcgctgtcccaggcgatgaacgattacaccgtgggcaacgaaagtttcgccagc
gccgaggcgagcgccgccgacatcatccggcgggtggcggcggcaccctggcatccgggc
acgctggtgaacatcaatttcccgacgcgggcggagccgctgggcgtgcgggtgaccgag
cagggtttccgcgactatggccatatcgccatcgagcggcgggtggacccgcgcggctat
ccctatttctggttcggctatggccgggagatcgagacgccggcgcaccgcaccgacctg
gaggcggtgcgcgccggctatgtcagcgtgacgccgctgcacctggacctgaccgcgcgg
gaggcgatggcggcgctggcggcgacgctggaatag

DBGET integrated database retrieval system