Sinocyclocheilus anshuiensis: 107654239 Help Entry 107654239         CDS       T04917                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism sanh  Sinocyclocheilus anshuiensis Brite KEGG Orthology (KO) [BR:sanh00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:sanh01002]     107654239   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107654239 Peptidases and inhibitors [BR:sanh01002]  Peptidase inhibitors   Family I25: cystatin family    107654239 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    107654239 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  107654239 NCBI-ProteinID:  XP_016296736 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MNVRCGGTSEAKDANEEIKSHAEDKAERKFDIFTAKSFKTQVVAGTNYFIKVHVGGDEYI HLRVYKTLPYAGEKLKLHSIQTSKAHHDPIEYF NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaatgtgcgctgtggtggaacatctgaggcgaaagatgccaatgaagagataaagtct catgccgaggataaagctgagcgcaagtttgacattttcactgccaaatcttttaaaaca caagttgttgcggggacaaattacttcattaaggtgcatgtaggtggggatgagtacatt catctacgtgtctataaaactctgccctatgctggagaaaaactgaagctgcacagcatt cagacatccaaggctcatcatgatcccattgagtacttctga

DBGET integrated database retrieval system