Sinocyclocheilus anshuiensis: 107657638 Help Entry 107657638         CDS       T04917                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04382   Cornified envelope formation sanh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sanh00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     107657638  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107657638  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107657638 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of microglial cells    107657638 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Astro_p19 EH Motif Other DBs NCBI-GeneID:  107657638 NCBI-ProteinID:  XP_016301277 UniProt:  A0A671LQD1 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MPSDLERAMETLITVFHRYASKESGNASTLNRRELKLLMETELANFMKSQKDPAAVDRIM RDLDANGDGEVDFEEFVSLVVGLSIACEQIYKMHKLGAGGVKKQ NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagcgatggagacgctgatcacagtgtttcaccgttatgcg agcaaagagagtggaaatgcatcaacattaaatcgcagagagctcaaactgctgatggag acagagttggccaactttatgaagtctcagaaggaccctgctgccgtagacaggattatg agggatttggatgctaatggtgatggagaggtggattttgaagagtttgtgtctcttgtg gtgggcctgtccattgcctgtgaacagatctacaagatgcacaagctgggggcagggggt gtcaaaaagcaataa

DBGET integrated database retrieval system