Sinocyclocheilus anshuiensis: 107658156 Help Entry 107658156         CDS       T04917                                  Name (RefSeq) calmodulin-alpha-like   KO K02183   calmodulin Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04020   Calcium signaling pathway sanh04070   Phosphatidylinositol signaling system sanh04114   Oocyte meiosis sanh04218   Cellular senescence sanh04261   Adrenergic signaling in cardiomyocytes sanh04270   Vascular smooth muscle contraction sanh04371   Apelin signaling pathway sanh04625   C-type lectin receptor signaling pathway sanh04744   Phototransduction sanh04910   Insulin signaling pathway sanh04912   GnRH signaling pathway sanh04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sanh00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     107658156    04020 Calcium signaling pathway     107658156    04070 Phosphatidylinositol signaling system     107658156  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     107658156    04218 Cellular senescence     107658156  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107658156   09152 Endocrine system    04910 Insulin signaling pathway     107658156    04912 GnRH signaling pathway     107658156    04916 Melanogenesis     107658156   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     107658156    04270 Vascular smooth muscle contraction     107658156   09157 Sensory system    04744 Phototransduction     107658156  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sanh01009]     107658156   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sanh04131]     107658156    03036 Chromosome and associated proteins [BR:sanh03036]     107658156   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107658156 Protein phosphatases and associated proteins [BR:sanh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107658156 Membrane trafficking [BR:sanh04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107658156 Chromosome and associated proteins [BR:sanh03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107658156 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107658156 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH UPF0154 Allatotropin-like_C Poly_export EF-hand_STIM1 SPARC_Ca_bdg Caleosin SAPC2_N EF_EFCAB10_C Cep290_N Motif Other DBs NCBI-GeneID:  107658156 NCBI-ProteinID:  XP_016302105 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKLLKVKPPEVTLVPTCISILSWNTNE TLGQAEFTRQKSDTFLITPK NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctgaccagttaacagaggagcagatcgccgagttcaaggaggctttctccttattc gacaaggatggtgatggcaccatcacgaccaaagagctgggcacagtcatgcggtcgctg ggtcagaaccccacggaggcagagctgcaggacatgatcaatgaggtggacgctgatgga aatggaaccatagatttcccagagttcttgacaatgatggccaggaaaatgaaggacaca gacagtgaggaagagattcgcgaggcttttcgggtatttgataagttgctcaaagtcaaa ccacctgaggtcacattagtgccgacatgcatctctattctctcctggaacacaaatgaa acactgggtcaagcagagttcacaagacagaagtctgacactttcctgataacaccaaag tga

DBGET integrated database retrieval system