Sinocyclocheilus anshuiensis: 107658571 Help Entry 107658571         CDS       T04917                                  Name (RefSeq) histone H2A.V-like   KO K11251   histone H2A Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh03082   ATP-dependent chromatin remodeling sanh04217   Necroptosis Brite KEGG Orthology (KO) [BR:sanh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     107658571  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     107658571  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sanh03036]     107658571   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107658571 Chromosome and associated proteins [BR:sanh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107658571 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107658571 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  107658571 NCBI-ProteinID:  XP_016302647 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MFQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP RHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgtttcagttccctgtaggtcgtatccacaggcacctgaagacccgaactaccagccat ggtcgtgttggagctacagcagcggtgtacagcgccgctatcttggagtacctgactgct gaggttttggagttggctggtaatgcctccaaggatctgaaggtgaagcgtatcactcca aggcatttacagctggccatccgtggtgatgaggagttggactcgcttatcaaagctact attgctggcggaggtgtgattccacacatccacaagtcactgattggaaagaagggccag cagaaaactgtataa

DBGET integrated database retrieval system