Sinocyclocheilus anshuiensis: 107663421 Help Entry 107663421         CDS       T04917                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04010   MAPK signaling pathway sanh04068   FoxO signaling pathway sanh04081   Hormone signaling sanh04114   Oocyte meiosis sanh04140   Autophagy - animal sanh04150   mTOR signaling pathway sanh04810   Regulation of actin cytoskeleton sanh04910   Insulin signaling pathway sanh04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:sanh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107663421    04068 FoxO signaling pathway     107663421    04150 mTOR signaling pathway     107663421   09133 Signaling molecules and interaction    04081 Hormone signaling     107663421  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107663421   09143 Cell growth and death    04114 Oocyte meiosis     107663421   09142 Cell motility    04810 Regulation of actin cytoskeleton     107663421  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     107663421    04914 Progesterone-mediated oocyte maturation     107663421  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sanh04052]     107663421 Cytokines and neuropeptides [BR:sanh04052]  Neuropeptides   Unclassified    107663421 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  107663421 NCBI-ProteinID:  XP_016309143 UniProt:  A0A671L9K3 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAVWLQAGALLFLLVISSVNVNAGAPQYLCGSHLVDALYLVCGPTGFFYNPKRDVDPLLG FLPPKSAQETEVADFAFKDHAELIRKRGVLELCCHRPCSIFELQNYCN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagtgtggctccaggctggtgctctgttgttcctgttggtcatctccagtgtgaat gttaacgcaggggccccgcagtacctgtgtggatcccatctggtcgatgccctctacctg gtctgtggtccaacaggcttcttctacaaccccaaaagagatgttgaccctcttctgggt ttccttcctccaaaatctgcccaggaaactgaggtggccgactttgcatttaaagatcat gccgagctgataaggaagagaggcgttctggagctgtgttgccacagaccctgcagtatc tttgaactgcagaattactgtaactaa

DBGET integrated database retrieval system