Sinocyclocheilus anshuiensis: 107668515 Help Entry 107668515         CDS       T04917                                  Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04020   Calcium signaling pathway sanh04070   Phosphatidylinositol signaling system sanh04114   Oocyte meiosis sanh04218   Cellular senescence sanh04261   Adrenergic signaling in cardiomyocytes sanh04270   Vascular smooth muscle contraction sanh04371   Apelin signaling pathway sanh04625   C-type lectin receptor signaling pathway sanh04744   Phototransduction sanh04910   Insulin signaling pathway sanh04912   GnRH signaling pathway sanh04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sanh00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     107668515    04020 Calcium signaling pathway     107668515    04070 Phosphatidylinositol signaling system     107668515  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     107668515    04218 Cellular senescence     107668515  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107668515   09152 Endocrine system    04910 Insulin signaling pathway     107668515    04912 GnRH signaling pathway     107668515    04916 Melanogenesis     107668515   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     107668515    04270 Vascular smooth muscle contraction     107668515   09157 Sensory system    04744 Phototransduction     107668515  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sanh01009]     107668515   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sanh04131]     107668515    03036 Chromosome and associated proteins [BR:sanh03036]     107668515   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107668515 Protein phosphatases and associated proteins [BR:sanh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107668515 Membrane trafficking [BR:sanh04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107668515 Chromosome and associated proteins [BR:sanh03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107668515 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107668515 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 SAPC2_N EFhand_Ca_insen Dockerin_1 EF-hand_EFHB_C BamM_C FCaBP_EF-hand Caleosin TerB DUF5580_M DUF1103 SPEF2_C EF-hand_STIM1 SurA_N_3 PA_Ig-like DUF2267 Motif Other DBs NCBI-GeneID:  107668515 NCBI-ProteinID:  XP_016315905 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MTLCCCFFCLCFPSLCGPLADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ NPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYIS AAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgaccttgtgctgctgcttcttctgcctctgctttccctctctctgtggcccactggct gaccaactcaccgaggagcaaattgctgagtttaaggaggctttctccttgtttgataag gatggtgacggtaccatcacaaccaaagagctgggcacagtgatgcgctcacttgggcag aaccccacggaggctgaactgcaggacatgatcaacgaggtggatgctgatggtaatgga accattgactttcccgagtttctgacaatgatggcccggaaaatgaaagacaccgacagt gaggaggagatccgcgaggctttcagagtgtttgacaaggatgggaacggctacatcagc gcagcagagcttcgccacgtcatgacaaacctgggtgagaagctaacggatgaagaggtg gacgaaatgatcagagaagctgacatcgacggcgacggtcaggtcaattacgaagaattt gtacaaatgatgacggcaaagtga

DBGET integrated database retrieval system