Sinocyclocheilus anshuiensis: 107673043 Help Entry 107673043         CDS       T04917                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04068   FoxO signaling pathway sanh04136   Autophagy - other sanh04140   Autophagy - animal sanh04621   NOD-like receptor signaling pathway sanh04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:sanh00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     107673043  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107673043    04136 Autophagy - other     107673043  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     107673043    04622 RIG-I-like receptor signaling pathway     107673043  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sanh04131]     107673043    04121 Ubiquitin system [BR:sanh04121]     107673043    03029 Mitochondrial biogenesis [BR:sanh03029]     107673043 Membrane trafficking [BR:sanh04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     107673043 Ubiquitin system [BR:sanh04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    107673043 Mitochondrial biogenesis [BR:sanh03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     107673043 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  107673043 NCBI-ProteinID:  XP_016321962 UniProt:  A0A671PSV0 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MSDNAESPTENQKDDPSIQHTATEHTGSSDEKKKIDVLLKAVGDTPIMKTKKWSVESGRT VQSLAQFISRFLKLDPSEQLFIYVNQSFAPSPDQEVGALFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacgcagaatctcctacagaaaatcaaaaagatgatccctcgatacaacac actgccactgaacacactggatcgtcggatgagaagaaaaagattgatgtgctgttgaag gcggtcggtgatacgcccatcatgaaaaccaaaaaatggtctgtggaaagcgggaggaca gtacagtcactcgctcagtttatctcacgctttctcaaactcgatcctagtgaacaactg ttcatttatgtcaatcagtcatttgctccatcaccagaccaggaagtgggtgcacttttt gagtgttttggaagtgatggtaaactagttctccattactgcaagtcccaggcctgggga tga

DBGET integrated database retrieval system