Sinocyclocheilus anshuiensis: 107675668 Help Entry 107675668         CDS       T04917                                  Name (RefSeq) GTPase HRas-like isoform X1   KO K02833   GTPase HRas Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04010   MAPK signaling pathway sanh04012   ErbB signaling pathway sanh04068   FoxO signaling pathway sanh04137   Mitophagy - animal sanh04140   Autophagy - animal sanh04144   Endocytosis sanh04150   mTOR signaling pathway sanh04210   Apoptosis sanh04218   Cellular senescence sanh04370   VEGF signaling pathway sanh04371   Apelin signaling pathway sanh04510   Focal adhesion sanh04540   Gap junction sanh04625   C-type lectin receptor signaling pathway sanh04810   Regulation of actin cytoskeleton sanh04910   Insulin signaling pathway sanh04912   GnRH signaling pathway sanh04916   Melanogenesis sanh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sanh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107675668    04012 ErbB signaling pathway     107675668    04370 VEGF signaling pathway     107675668    04371 Apelin signaling pathway     107675668    04068 FoxO signaling pathway     107675668    04150 mTOR signaling pathway     107675668  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107675668    04140 Autophagy - animal     107675668    04137 Mitophagy - animal     107675668   09143 Cell growth and death    04210 Apoptosis     107675668    04218 Cellular senescence     107675668   09144 Cellular community - eukaryotes    04510 Focal adhesion     107675668    04540 Gap junction     107675668   09142 Cell motility    04810 Regulation of actin cytoskeleton     107675668  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107675668   09152 Endocrine system    04910 Insulin signaling pathway     107675668    04912 GnRH signaling pathway     107675668    04916 Melanogenesis     107675668  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107675668  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sanh04131]     107675668   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107675668    04031 GTP-binding proteins [BR:sanh04031]     107675668 Membrane trafficking [BR:sanh04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     107675668  Endocytosis   Macropinocytosis    Ras GTPases     107675668 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    107675668   Exosomal proteins of colorectal cancer cells    107675668 GTP-binding proteins [BR:sanh04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     107675668 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  107675668 NCBI-ProteinID:  XP_016325572 UniProt:  A0A671NME2 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatacgaccccactatagaggactcctac aggaagcaggtggtgattgacggggagacgtgtctcctggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtgtttgccatcaataacaccaagtcctttgaggacattcatcagtacagggaacagatc aaacgggtgaaggactcggatgatgtgcccatggtgctggtgggtaacaaatgtgacctc ccggcccggacggtggacacgcgacaagctcaggagctcgcgcgcagctacgggatcccc ttcatcgagacctcggccaaaacacgacaaggtgtggaggatgcgttttacacgctggtg cgagagatccgtcagcacaagatgaggaagctgaacccgccggacgagagcggacaggac tgcatgagctgccgctgtgtcgtgtcgtga

DBGET integrated database retrieval system