Sinocyclocheilus anshuiensis: 107678421 Help Entry 107678421         CDS       T04917                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04137   Mitophagy - animal sanh04140   Autophagy - animal sanh04144   Endocytosis sanh04145   Phagosome sanh04148   Efferocytosis sanh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sanh00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107678421    04145 Phagosome     107678421    04140 Autophagy - animal     107678421    04137 Mitophagy - animal     107678421    04148 Efferocytosis     107678421  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107678421  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sanh04131]     107678421   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107678421    04031 GTP-binding proteins [BR:sanh04031]     107678421 Membrane trafficking [BR:sanh04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     107678421 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107678421   Exosomal proteins of other body fluids (saliva and urine)    107678421   Exosomal proteins of colorectal cancer cells    107678421   Exosomal proteins of bladder cancer cells    107678421 GTP-binding proteins [BR:sanh04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107678421 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP Septin nSTAND3 AAA_7 AAA_16 NTPase_1 G-alpha AAA_22 AAA_24 SRPRB ATPase_2 ABC_tran AAA_5 ATP-synt_ab AAA_14 NACHT MCM Motif Other DBs NCBI-GeneID:  107678421 NCBI-ProteinID:  XP_016329156 UniProt:  A0A671T9Z4 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTMDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQESVE TYDFPDQIKLRDDRPVSSSDGCSC NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcctctcgtaagaaggtgctgctcaaagtgatcatcctaggggattctggagttggg aagacctctttgatgaaccagtatgtgaataataagttcagtaatcagtataaggccact attggagccgacttcctgactaaggaggtgatggtggacgacagactggtcaccatgcag atttgggacacggcgggacaggagcgctttcagtctctgggcgtggcgttctacagaggg gcagactgttgcgtgctggtgtacgacgtcacggcaccaactacattcaagactatggac agctggagggacgagtttctcattcaggccagtcctcgtgacccagagaacttccccttt gttgtgctgggcaacaaaatcgacctggagaaccggcaggtaacgacaaagcgagctcaa gcgtggtgtcagagtaagaacaacatcccctattttgagaccagtgccaaagaagccatt aacgtggagcaggccttccaaactatcgctcgcaatgcacttaaacaggagtcagtggag acgtatgatttccctgaccagattaaactaagagacgacagaccggtgtctagcagtgat ggctgcagctgctga

DBGET integrated database retrieval system