Sinocyclocheilus anshuiensis: 107678795 Help Entry 107678795         CDS       T04917                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04382   Cornified envelope formation sanh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sanh00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     107678795  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107678795  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107678795 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of microglial cells    107678795 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  107678795 NCBI-ProteinID:  XP_016329682 UniProt:  A0A671MEK2 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MPSELETAMESLIMVFHRYAGKEGKSGTLTRRELRTLMENELSGFLKSQKDPTTIDRIMK DLDANGDGEVNFEEFVSLVVGLSIACEACYRMQLKKTQSWK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccatctgaactagagaccgccatggagtccctcatcatggtattccaccgctacgct ggaaaagagggcaagagcggcaccctgacccgccgtgaactccgaaccctgatggagaac gagctctctgggtttctcaagtctcagaaggatccgactaccatcgacagaattatgaag gacttggatgccaatggagatggggaggtgaactttgaggagtttgtgtctttggttgtg ggtttgtccatcgcctgtgaagcgtgctacaggatgcagttaaagaagacacaaagctgg aaatga

DBGET integrated database retrieval system