Sinocyclocheilus anshuiensis: 107678968 Help Entry 107678968         CDS       T04917                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism sanh  Sinocyclocheilus anshuiensis Brite KEGG Orthology (KO) [BR:sanh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sanh03036]     107678968   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107678968 Chromosome and associated proteins [BR:sanh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107678968 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107678968 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  107678968 NCBI-ProteinID:  XP_016329853 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search MPEPAKSAPKKGSKKTVSKTAAKGGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMGI MNSFVNDIFERIAGEASRLAH NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccagcgaagtccgcgcctaagaagggctcaaagaagaccgtctctaagacc gcagcgaagggaggaaagaagcgcagaaagagcaggaaggagagctacgccatctacgtc tacaaagtgctgaagcaggttcatcctgacaccgggatctcttcgaaggcgatgggcatc atgaactctttcgtcaacgacatcttcgagcgcatcgccggtgaagcgtctcgtctcgct cactag

DBGET integrated database retrieval system