Sinocyclocheilus anshuiensis: 107689973 Help Entry 107689973         CDS       T04917                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04020   Calcium signaling pathway sanh04070   Phosphatidylinositol signaling system sanh04114   Oocyte meiosis sanh04218   Cellular senescence sanh04261   Adrenergic signaling in cardiomyocytes sanh04270   Vascular smooth muscle contraction sanh04371   Apelin signaling pathway sanh04625   C-type lectin receptor signaling pathway sanh04744   Phototransduction sanh04910   Insulin signaling pathway sanh04912   GnRH signaling pathway sanh04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sanh00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     107689973    04020 Calcium signaling pathway     107689973    04070 Phosphatidylinositol signaling system     107689973  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     107689973    04218 Cellular senescence     107689973  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107689973   09152 Endocrine system    04910 Insulin signaling pathway     107689973    04912 GnRH signaling pathway     107689973    04916 Melanogenesis     107689973   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     107689973    04270 Vascular smooth muscle contraction     107689973   09157 Sensory system    04744 Phototransduction     107689973  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sanh01009]     107689973   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sanh04131]     107689973    03036 Chromosome and associated proteins [BR:sanh03036]     107689973   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107689973 Protein phosphatases and associated proteins [BR:sanh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107689973 Membrane trafficking [BR:sanh04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107689973 Chromosome and associated proteins [BR:sanh03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107689973 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107689973 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 CFAP251_C EF-hand_8 AIF-1 EF-hand_5 EH FlgD GPHH Motif Other DBs NCBI-GeneID:  107689973 NCBI-ProteinID:  XP_016343673 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MAKFLSQTQIDEFKECFSLYDKKRKGKIEAKDLITVMRCLGTSPTYNEVDRHLQIHKIDK TGELDFSTFLTMMHRQMQQEDPKTEILEAMRMTDKHKKGCILASELRAKLTGLGEKLTDK EVDELFKEANVGRDGLVYYEEFTRMVTLPTVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcaaaattcttatcacaaactcagattgatgagttcaaagaatgtttctcgctttat gacaagaagcgaaaggggaagattgaagccaaagaccttattacagtcatgcgctgtctg ggtacaagtcccacatataatgaagtggaccgacatctgcaaatccacaaaatagataag acaggggagttggatttttctacatttctaaccatgatgcacagacagatgcagcaggaa gatcctaagactgaaattctggaggctatgcgcatgacggataaacacaagaagggctgc attctggcctctgagctacgggccaaactcacaggcttgggagaaaagctcactgataaa gaagtggatgagctttttaaagaggctaatgttggacgtgatggacttgtttactatgag gagttcaccagaatggtcacacttcctacagttgactactag

DBGET integrated database retrieval system