Sinocyclocheilus anshuiensis: 107692705 Help Entry 107692705         CDS       T04917                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04060   Cytokine-cytokine receptor interaction sanh04218   Cellular senescence sanh04620   Toll-like receptor signaling pathway sanh04621   NOD-like receptor signaling pathway sanh04622   RIG-I-like receptor signaling pathway sanh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sanh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107692705  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107692705  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107692705    04621 NOD-like receptor signaling pathway     107692705    04622 RIG-I-like receptor signaling pathway     107692705  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107692705  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sanh04052]     107692705    00536 Glycosaminoglycan binding proteins [BR:sanh00536]     107692705 Cytokines and neuropeptides [BR:sanh04052]  Cytokines   Chemokines    107692705 Glycosaminoglycan binding proteins [BR:sanh00536]  Heparan sulfate / Heparin   Chemokines    107692705 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107692705 NCBI-ProteinID:  XP_016347353 UniProt:  A0A671KBC3 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MHCEIFLVSVIVSLGFLTIGEGMSLRGLGVDPRCRCIETESRRIGKQIESVELFPPSSHC KDTEIVATLKISGKEICLDPTAPWVKKVIEKIIANKAP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcactgcgaaatctttttagtctctgttatcgtttcccttggattcctgaccattggt gaaggaatgagtcttagaggtctgggtgtagatccacgctgtcgctgcattgaaactgag agtcgacgcattggaaaacagatagagagtgtggagctcttccctccaagctcacactgt aaagacacagagatcgttgccaccctgaagatatctgggaaagagatctgtctggaccct actgcaccctgggttaagaaggtcattgagaagatcattgccaacaaagccccatga

DBGET integrated database retrieval system