Sinocyclocheilus anshuiensis: 107703977 Help Entry 107703977         CDS       T04917                                  Name (RefSeq) claudin-like protein ZF-A89   KO K06087   claudin Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh03272   Virion - Hepatitis viruses sanh04382   Cornified envelope formation sanh04514   Cell adhesion molecule (CAM) interaction sanh04530   Tight junction Brite KEGG Orthology (KO) [BR:sanh00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     107703977  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     107703977  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     107703977  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     107703977  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sanh03037]     107703977    04147 Exosome [BR:sanh04147]     107703977 Cilium and associated proteins [BR:sanh03037]  Other cilia and associated proteins   Stereociliary proteins    107703977 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    107703977   Exosomal proteins of colorectal cancer cells    107703977 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin TMEM37 TMEM100 DUF7548 Motif Other DBs NCBI-GeneID:  107703977 NCBI-ProteinID:  XP_016362278 UniProt:  A0A671SHK3 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MASVGMQLLGCILALFGWIGVIIVCALPMWRVTAFIGTNIVTSQIFWEGIWMSCVVESTG QMQCKVYDSMLALSPDLKAARVLVVFSIVVGIAAILVALVSGKCTDFIAEERGKVKASIV SGLVLMVSGVLCLITVSWTAVIIVNDFYNPLLLDAQRRELGA NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggcgtctgtgggcatgcagttactgggttgcatcctggccctgtttggctggattgga gtgataattgtgtgcgccctacccatgtggagagtaacagccttcattggcaccaacatt gtgacctctcagatcttctgggaggggatctggatgagctgtgtggtggagagcacagga cagatgcaatgtaaggtctacgactccatgctggcgctgagccccgatctgaaggctgct cgcgtcctggtggtgttttccatcgtggtgggcatcgctgcgattctcgtggcgctcgtc tcagggaaatgcaccgacttcatagctgaggaacgaggaaaagtgaaagcatccattgtt tctgggctggttctgatggtctctggagttttgtgtcttatcactgtgtcctggactgct gtcattatcgtaaacgacttctacaatcccctgttactggatgctcagcgcagggagctg ggggcttga

DBGET integrated database retrieval system