Streptomyces anulatus: KZO11_09630 Help Entry KZO11_09630       CDS       T09280                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sanl  Streptomyces anulatus Pathway sanl00998   Biosynthesis of various antibiotics sanl01100   Metabolic pathways sanl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sanl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KZO11_09630    00074 Mycolic acid biosynthesis     KZO11_09630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KZO11_09630 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QYA93953 LinkDB All DBs Position 2193934..2194182 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVTGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcaccggtctcgccgagatcgtcaacgagatcgcc ggtatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgccgccgactacatcctgaagcac cagggctga

DBGET integrated database retrieval system